PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0011100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 92aa    MW: 10466.2 Da    PI: 8.5098
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0011100.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.8e-075687132
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                       +g+WT++Ed +lv  v+++G ++W+  a+  g
  ORGLA05G0011100.1 56 KGPWTEQEDVQLVWFVRLFGERRWDFLAKVSG 87
                       79***********************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.5875192IPR017930Myb domain
SuperFamilySSF466894.49E-75385IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-75589IPR009057Homeodomain-like
PfamPF002491.4E-55687IPR001005SANT/Myb domain
CDDcd001671.35E-45889No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MVVKKAATMA EAEAEEEMMM RMMCGSGGNE MMKTKMKKKN REGEEEEVSG GGRMRKGPWT  60
EQEDVQLVWF VRLFGERRWD FLAKVSGLRG GG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0939211e-148AC093921.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0041A22, complete sequence.
GenBankAC1085041e-148AC108504.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1654_B10, complete sequence.
GenBankAK0992231e-148AK099223.1 Oryza sativa Japonica Group cDNA clone:J013091O17, full insert sequence.
GenBankAK1116341e-148AK111634.1 Oryza sativa Japonica Group cDNA clone:J013119H17, full insert sequence.
GenBankAP0149611e-148AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126131e-148CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
GenBankCT8295361e-148CT829536.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA107P09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLI1PRW37e-59I1PRW3_ORYGL; Uncharacterized protein
STRINGORGLA05G0011100.12e-58(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3776533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.17e-15myb domain protein 48